PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00026639-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 299aa    MW: 32995.7 Da    PI: 5.3857
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00026639-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR175.51.1e-23162250291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++YA+ +GF+vr+ k+++   ++++ ++t++Cskeg ++++ ++ +    +++etrtgC+a++    +++g+w+v+++++eHnHe+
  SMil_00026639-RA_Salv 162 LYCDYATAMGFNVRRGKQYYFMGTKRVRSKTYCCSKEGVKDDKADT-NGVGYKKPETRTGCRAMISFICDDSGQWKVSRFVKEHNHEM 248
                            69***************************************99988.888899**********************************9 PP

                   FAR1  90 ap 91 
                            ap
  SMil_00026639-RA_Salv 249 AP 250
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.4E-20162250IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHPKLLSNSA SAVPAATTSA VALVNHAPPS IAGQFLYSTL VLPEVPLIEF LCTWIKWHDS  60
EFYVVITTSY YELRMSVYSA LLTEAGLLTL RLLYFTEMEN SGFDLELHGA ACGDSDEEGV  120
ALPRSVGEVV DGNEGQDEGH ILELEKKLLE QVVYSEEEAY MLYCDYATAM GFNVRRGKQY  180
YFMGTKRVRS KTYCCSKEGV KDDKADTNGV GYKKPETRTG CRAMISFICD DSGQWKVSRF  240
VKEHNHEMAP PYAKPLVKSG QAILAANVYG SGGALESLVS IASLAHAFIL SNVFFIAMK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093602.11e-119PREDICTED: uncharacterized protein LOC105173527 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1451779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-14FAR1-related sequence 5